PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02208.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 158aa    MW: 17460.2 Da    PI: 10.3696
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02208.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.12.9e-1677138162
                              XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                              eke kr +r+ +NR++A+  R+RKka++ eLe+kvk Le+ N++L+++l++l++e + l++ 
  Rsa1.0_02208.1_g00006.1  77 EKETKRLKRLLRNRVSAQQARERKKAYLGELENKVKDLENNNSELQERLSTLQNENQMLRQI 138
                              899******************************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000415.8E-67692IPR001630cAMP response element binding (CREB) protein
PfamPF001708.6E-1577139IPR004827Basic-leucine zipper domain
SMARTSM003384.0E-1777141IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.72579142IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.56E-1481139No hitNo description
Gene3DG3DSA:1.20.5.1704.5E-1881141No hitNo description
CDDcd147042.68E-1582133No hitNo description
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
PRINTSPR000415.8E-694114IPR001630cAMP response element binding (CREB) protein
PRINTSPR000415.8E-6114131IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MQEQATSSLA ASSLPSSSER SSSSNPHLEI KEGLESDEEI RRVPEFAKET SGSGNGQDRA  60
QTAVGEGQRK RGRTPAEKET KRLKRLLRNR VSAQQARERK KAYLGELENK VKDLENNNSE  120
LQERLSTLQN ENQMLRQILK NTTGNKRGGG GPNADASL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_B1e-16102141342Transcription factor HY5
2oqq_A1e-16102141342Transcription factor HY5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3867721e-126EU386772.1 Brassica rapa subsp. rapa cultivar Tsuda elongated hypocotyl 5 protein (hy5) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013668083.13e-78PREDICTED: transcription factor HY5
SwissprotO246461e-71HY5_ARATH; Transcription factor HY5
TrEMBLA0A078BYF73e-78A0A078BYF7_BRANA; BnaA10g21200D protein
STRINGscaffold_601144.16e-77(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56912749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.11e-64bZIP family protein